x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300002037
3300002037: Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_B1
Overview
| Basic Information |
| IMG/M Taxon OID | 3300002037 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0103015 | Gp0060464 | Ga0016928 |
| Sample Name | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_B1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of New South Wales |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 800993314 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra → Delisea Pulchra Microbial Communities From Sydney, Australia, Affected By Bleaching Disease |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information |
| Location | Bare Island, Sydney, Australia |
| Coordinates | Lat. (o) | -33.59 | Long. (o) | 151.13 | Alt. (m) | N/A | Depth (m) | 5 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F015656 | Metagenome / Metatranscriptome | 253 | Y |
| F095570 | Metagenome / Metatranscriptome | 105 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| BIB12012_10017070 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | 2492 | Open in IMG/M |
| BIB12012_10139174 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 767 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| BIB12012_10017070 | BIB12012_100170701 | F015656 | RIIIIMKVFPEYFDQYQFVLNRENMHTIKRPYINFYKTLNFAFQEYNANLKLQCVHWQRLVHACVNVFGYFEFMKNIRCFESAEYFHQCLQLNSFFSYHKKYYPQEYYTSEYFQVSPHYDSIFNSD* |
| BIB12012_10139174 | BIB12012_101391741 | F095570 | MTEYLYDRDNPKSNLRQKLTGVEGMLYGVPNLNERAEMINRSLLKHTDGDITKWVQQTQKPRDEA* |
