Sample 3300001929

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001929

3300001929: Marine microbial communities from the Tropical South Pacific Ocean - GS040

Overview

Basic Information
IMG/M Taxon OID	3300001929 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0055716 \| Gp0056502 \| Ga0016861
Sample Name	Marine microbial communities from the Tropical South Pacific Ocean - GS040
Sequencing Status	Permanent Draft
Sequencing Center	J. Craig Venter Institute (JCVI)
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	610868
Sequencing Scaffolds	1
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED161	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Marine Microbial Communities From Global Ocean Sampling (Gos)
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	South Pacific Ocean
Coordinates	Lat. (^o)	-4.498889	Long. (^o)	-105.07	Alt. (m)	N/A	Depth (m)	2.2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017658	Metagenome	239	Y
F070220	Metagenome	123	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
GOS2255_10029	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED161	1764	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
GOS2255_10029	GOS2255_100292	F070220	MKCEKCGSQDIKVRETIYRKAEQTKGFRNKSSTPYVYRRRVCSCGHRFTTREYTIPDLIAFGKQGYLEMIDDLMPNK*
GOS2255_10029	GOS2255_100293	F017658	MNFMEELEKETQAMLKQINIRKIEKTNNAKKRIAELKRLIKFWEKEL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.