


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001789 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0099430 | Gp0055296 | Ga0013023 |
| Sample Name | BioPara_130528_S2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 194813313 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae → Shimazuella → Shimazuella kribbensis | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 1 |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Biogas Reactor Microbial Communities From The Max Planck Institute, Germany |
| Type | Engineered |
| Taxonomy | Engineered → Solid Waste → Grass → Composting → Bioreactor → Biogas Reactor → Biogas Reactor Microbial Communities From The Max Planck Institute, Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051061 | Metagenome / Metatranscriptome | 144 | N |
| F066897 | Metagenome / Metatranscriptome | 126 | Y |
| F070019 | Metagenome / Metatranscriptome | 123 | N |
| F103107 | Metagenome / Metatranscriptome | 101 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| BP130528S2_1710598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae → Shimazuella → Shimazuella kribbensis | 500 | Open in IMG/M |
| BP130528S2_1718969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → unclassified Clostridiaceae → Clostridiaceae bacterium | 547 | Open in IMG/M |
| BP130528S2_1721004 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 560 | Open in IMG/M |
| BP130528S2_1731064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| BP130528S2_1710598 | BP130528S2_17105981 | F070019 | EKEFIEDDKVDFILDLFSKAGKKLDDSVKIVYEHGLEEDGSGGIEDYEVVKYMQFAQNLSYNDYVILNAINEKANLLGIIDELGISKDRLNKSLEILEQNGYIKGFDITRNGKNILKNTNIQVVRTYYRYTVKPGLGDPIIPSSRKFCIQMITENRIYTKKEIDMI |
| BP130528S2_1718969 | BP130528S2_17189691 | F103107 | YWYDEKTGGYVELAGTRWDGDLSDEQLLARALEEAKEAGLDLSYGKILIGEEEEEE* |
| BP130528S2_1721004 | BP130528S2_17210041 | F066897 | MSSKWFWLILIAIILVSSVFLWHNHTSTQEALIKAQETIKETKQALRESQDALQRIDEITQKLQDVTRMAKEAGDKRVEEIKYVSDDDFLNIANQYSALMVERVDF* |
| BP130528S2_1731064 | BP130528S2_17310641 | F051061 | LYLPELDETVYWYPMTAGERQRILNAAGFKWARDAVQMDNAKYKASLIIEKLEDKDGKKIFSNTPEHKDLLINRIDDELLSRIASAIDPPKSEEQQIEEAKND* |
| ⦗Top⦘ |