| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001773 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0094730 | Gp0055289 | Ga0013000 |
| Sample Name | Glenwood Hot Springs L4M |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 55809917 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Subterranean Sulfidic Spring Microbial Communities From The Max Planck Institute, Germany |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Subterranean Sulfidic Spring → Subterranean Sulfidic Spring Microbial Communities From The Max Planck Institute, Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Glenwood Hot Springs, Colorado, USA | |||||||
| Coordinates | Lat. (o) | 39.54798 | Long. (o) | -107.3226 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033261 | Metagenome / Metatranscriptome | 178 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| DRAFT_1002448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1889 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| DRAFT_1002448 | DRAFT_10024483 | F033261 | GQEFAHRIGKHHLAFDILPPGYTLTTTRDEDGHLQRQVEYDTTSFFLSAWLHCLGFNLMTLFGQALGGECTKMWAGTLLRKFIRRPATLYLVGKELHVVFDPFPDQEELRPLLEELNAKRVAIPWLNGLIIQFSIADHEPIHPLKVHKNRNRIFGHQ* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |