| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001737 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0058670 | Gp0054037 | Ga0026867 |
| Sample Name | Saline benthic water microbial community from Etoliko Lagoon, Greece |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 68840610 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water And Sediment → Saline Water And Sediment Microbial Community From Etoliko Lagoon, Greece |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → lagoon → saline water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Hypersaline (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Etoliko Lagoon, Greece | |||||||
| Coordinates | Lat. (o) | 38.468307 | Long. (o) | 21.333032 | Alt. (m) | N/A | Depth (m) | 25 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F054439 | Metagenome | 140 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| JGI997J19993_1000323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium | 15340 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| JGI997J19993_1000323 | JGI997J19993_100032311 | F054439 | MKQMAYARQLFGAKGKNKKQIALDVGYSPNVANSIKTHIENKPGFNYAMSALAVESNNLALEALSEFKARGLKDFSNKELTGALNAISNAWSKFNAPAIEQSNNAKEGNKLRKVILQQIENQTVNNNVKEEEKPRVIDVEVDDPNDF* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |