NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001646

3300001646: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042



Overview

Basic Information
IMG/M Taxon OID3300001646 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0085736 | Gp0057367 | Ga0003881
Sample NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size7969357
Sequencing Scaffolds6
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
All Organisms → cellular organisms → Bacteria2
Not Available1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → land → forest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.550409Long. (o)-72.180244Alt. (m)N/ADepth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004500Metagenome / Metatranscriptome435Y
F014331Metagenome / Metatranscriptome264Y
F023941Metagenome / Metatranscriptome208Y
F030179Metagenome / Metatranscriptome186Y
F066205Metagenome127Y
F088851Metagenome / Metatranscriptome109Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20276J16322_100046All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → Mesorhizobium onobrychidis1834Open in IMG/M
JGI20276J16322_100104All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1448Open in IMG/M
JGI20276J16322_100289All Organisms → cellular organisms → Bacteria920Open in IMG/M
JGI20276J16322_100514Not Available684Open in IMG/M
JGI20276J16322_100786All Organisms → cellular organisms → Bacteria576Open in IMG/M
JGI20276J16322_100898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis550Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20276J16322_100046JGI20276J16322_1000463F023941DSPLEEDGFEPVWGFSCQVVIFGLLPVLCSELEKPFFVPSPAIRFAERAEGVKGPKR*
JGI20276J16322_100104JGI20276J16322_1001041F088851VDSRLRRSPPDRASAVPYGQAGENATRFPHLAHRSAAAHKLHSTPQQDRMNLISGKGE
JGI20276J16322_100289JGI20276J16322_1002892F030179MITAGVSRVASGLLCVHAIAITPAGPMQLVRSSLSIVNGLPCVTVRSAPAIVVSGPAQRSLTLWPARSPSRLATLYIESSDSFVASAAVSIATGWSEPVPGRELHPLKSSAFHGALLRQLSGG*
JGI20276J16322_100514JGI20276J16322_1005141F004500RARLGAFCPRSTFPGTSVPSAGGTGLAVVAQSVPRVRVKAVPAFPVPQSALAAQPGQINNYNHMTSVYAVGEGASGPPPYREPV*
JGI20276J16322_100786JGI20276J16322_1007861F014331MKAPACDPGDFCTALGAESTLLIPEIAKSASTPKGFQHVSPFTFFEVGFIGWIVRVSFAFDLDVSFDGSALGVVQPDSSWPSFVIAGFPEEGPVTVPTPFKVFRFDPARGL
JGI20276J16322_100898JGI20276J16322_1008981F066205LDFPQSIPDHYEISVASDGQASYDSTGKLTPDSEPGDPFHLEFTISPASTKRIFDLAAKAKYFDGKIDSGKRNLASTGAKVLTYKDATRNSRAEYNYSPVPAVQEITAVFQNMSSTLEFGRRLDYYHHHQKLALEDELKRMEEMAKEKNLEEIQAVAPILQRIVDDKSVLNITRARAQRLLNR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.