


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001391 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0090378 | Gp0055594 | Ga0012453 |
| Sample Name | Hydrothermal vent microbial communities from the Southwest Indian Ridge - SWIR1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 55292183 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | ||||||||
| Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008223 | Metagenome / Metatranscriptome | 337 | Y |
| F059476 | Metagenome / Metatranscriptome | 134 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SWIR1_1016497 | Not Available | 993 | Open in IMG/M |
| SWIR1_1030884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 557 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SWIR1_1016497 | SWIR1_10164972 | F008223 | MGIFKKLFGKQAHTPTVTEAVGKIIDRFATATSMGVDREALARYPARQYQVMAFHYGAIDYLSQQHQLDETQTLGVFVIFINTYFTMPITETGSISERLRGFSEKPDERRYMEAGADAFRRWHEQNERRAPLELGEMLNKE* |
| SWIR1_1030884 | SWIR1_10308842 | F059476 | LVKKMAEQNNRQQSIRMVITVVLLVLLALGFFAASFFALS* |
| ⦗Top⦘ |