Sample 3300001389

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001389

3300001389: Benzene-degrading bioreactor methanogenic microbial communities from Toronto, Canada - k91 assembly

Overview

Basic Information
IMG/M Taxon OID	3300001389 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0090635 \| Gp0052049 \| Ga0012451
Sample Name	Benzene-degrading bioreactor methanogenic microbial communities from Toronto, Canada - k91 assembly
Sequencing Status	Permanent Draft
Sequencing Center
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	9042418
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Benzene-Degrading Bioreactor Methanogenic Microbial Communities From Toronto, Canada
Type	Engineered
Taxonomy	Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor Methanogenic → Benzene-Degrading Bioreactor Methanogenic Microbial Communities From Toronto, Canada

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	na → na → na

Location Information
Location	Toronto, Canada
Coordinates	Lat. (^o)	43.66266	Long. (^o)	-79.3917	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050029	Metagenome / Metatranscriptome	146	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
BDMCk91_101539	All Organisms → cellular organisms → Bacteria	3105	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
BDMCk91_101539	BDMCk91_1015396	F050029	MATILIHWKDKNLPAMEIKDAAYKGADSSIIKITSNGNEYWFNWNECWFLETTSTNDIPI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.