Sample 3300001286

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300001286

3300001286: Groundwater microbial communities from S. Glens Falls, New York, USA - Naphthalene biodegradation metagenome 12C5dose

Overview

Basic Information
IMG/M Taxon OID	3300001286 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0069861 \| Gp0054471 \| Ga0000298
Sample Name	Groundwater microbial communities from S. Glens Falls, New York, USA - Naphthalene biodegradation metagenome 12C5dose
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	15388853
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa
Type	Environmental
Taxonomy	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Coal-Tar-Waste-Contaminated Well In S. Glens Falls, New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater biome → anthropogenic contamination feature → contaminated water
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	S. Glens Falls, New York, USA
Coordinates	Lat. (^o)	43.292222	Long. (^o)	-73.604444	Alt. (m)	N/A	Depth (m)	98
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
JGI12103J14257_105705	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12103J14257_105705	JGI12103J14257_1057051	F077438	EEFSVTSLCCVYSTHRVERSFTQSRLETLFLWNLQVEISAALRSMVE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.