| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001221 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0087863 | Gp0055918 | Ga0012428 |
| Sample Name | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Tennessee |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 1956787 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | East Tennessee Research and Education Center, Knoxville, Tennessee, USA | |||||||
| Coordinates | Lat. (o) | 35.9606 | Long. (o) | -83.9208 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000788 | Metagenome / Metatranscriptome | 891 | Y |
| F029958 | Metagenome / Metatranscriptome | 186 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SwM_12973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| SwM_14816 | Not Available | 613 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SwM_12973 | SwM_129731 | F000788 | MKPRTVYEKAVQDFTEIAQQLARLNQHFRQASFSEFEMLMGLDDEVLKRYGLPKPTVKRALIEVYQTVVLDQAR* |
| SwM_14816 | SwM_148162 | F029958 | VLTTLKWAPTFSSIYYEQVALLHPPNRLASDETEEFLPKHVPHV* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |