| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001102 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0085351 | Gp0054842 | Ga0012563 |
| Sample Name | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY67 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute (JCVI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 409968234 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Macroalgal Surface Microbial Communities |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Botany Bay, Sydney, NSW, Australia | |||||||
| Coordinates | Lat. (o) | -33.966629 | Long. (o) | 151.166614 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F028441 | Metagenome / Metatranscriptome | 191 | Y |
| F040117 | Metagenome / Metatranscriptome | 162 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| BBAY67_10001407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 14824 | Open in IMG/M |
| BBAY67_10090603 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea | 538 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| BBAY67_10001407 | BBAY67_100014072 | F028441 | MTLKQLIKLENKAKEVWVVSPTLHYDIENKEFSEIVSVNLGEQTKYRYIVPGSRLVEKNIKAYKKMYDVSEAEIATNFLILPASEFIPFLEETAIYNASTDCVACAAPATENSNDVIKFNEDTSKAMAKAFKALWKKYKRTNP* |
| BBAY67_10090603 | BBAY67_100906031 | F040117 | VRLKSVRMKGHRNWHWFDVRFGWKFHNFVWIPQLWLFAIVYVITPVWRRNDERYHLRYGDGEDDDVEDVEPFMDYQSRKKPLTRRKYADGVKLVIGETEQFDYAPEQPQRYR* |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |