NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000687

3300000687: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50



Overview

Basic Information
IMG/M Taxon OID3300000687 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0075432 | Gp0054323 | Ga0001973
Sample NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size6014814
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1
Not Available2
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AC87j11
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameTropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → tropical forest → forest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)N/ADepth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000466Metagenome / Metatranscriptome1105Y
F003090Metagenome / Metatranscriptome508Y
F007624Metagenome / Metatranscriptome348N
F034030Metagenome / Metatranscriptome175Y
F045461Metagenome152N
F057789Metagenome135N
F060758Metagenome / Metatranscriptome132Y
F097844Metagenome / Metatranscriptome104N
F104209Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12487J11892_100183All Organisms → cellular organisms → Bacteria1211Open in IMG/M
JGI12487J11892_100189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1197Open in IMG/M
JGI12487J11892_100272Not Available1035Open in IMG/M
JGI12487J11892_100402All Organisms → cellular organisms → Bacteria843Open in IMG/M
JGI12487J11892_100481All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium775Open in IMG/M
JGI12487J11892_100733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium661Open in IMG/M
JGI12487J11892_100965All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. AC87j1607Open in IMG/M
JGI12487J11892_101564Not Available507Open in IMG/M
JGI12487J11892_101636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12487J11892_100183JGI12487J11892_1001832F104209THAHSTLSAETTHVQVFYRFHPLYSSTLQILRRPKRGDGAVCVSDPMGRRLKIPMWMLLPNSAEMKIAEQAYLSKEALLSLVLLVSTPREIENRVHANLLQAVVDTCKGGQRATTTTPGAGDRKSGGHGADRRRDTNRTDRSHGPHSGGGLSNGRRKSR*
JGI12487J11892_100189JGI12487J11892_1001891F097844LNKFISAIIAYGPKNKTKKARMARKAARRKRFAAMKRH*
JGI12487J11892_100272JGI12487J11892_1002721F034030DQKGRRMRRREFILLGAYVIAGCVAAVTSADLALAQAKNSTSMEDRLSAKIRCQDFQKNSDGKWTSSSKAKIGKIDFSNHTFGVDEVDIGGADLATFLNRKCAAH*
JGI12487J11892_100402JGI12487J11892_1004021F045461PILFFAYCTCARKEIAVRQPTAPHSEFSLRSMLFGAVFIIMFVAAVIIDLAALLQFSGLVNGLPANILEMAGVLTGLTIFPLLVMGMSVSVDLNHK*
JGI12487J11892_100481JGI12487J11892_1004812F007624RPTCPKHPKQRVHRHGFYVRFENCDSQRRLRIERFVCPRCGRTLSVLPKNRLPYVAVNTTILESDFDARASGTDPPSCSEKERGCLGRAFERFADRVAPLCALLGQMIRGIKPSVSECWRALRQLDNLEGILLLLGTKFNTSLLADYRCLQPGF*
JGI12487J11892_100733JGI12487J11892_1007331F000466TYMTTPEAWQRWKKLPSQGVVKRDWVPTGRIDFATRFYGNLEDSDQPSEFKLIVEERRIVESITGNENLEIQWRLATLNEAKVVVAQYHKYLSENSLIKSVFDEPASLPPPKRIQKIQESTAA*
JGI12487J11892_100965JGI12487J11892_1009651F057789MSETALQFTGTDLRGLLDVLLEALKVIRRAGRRPTITVNGKLYASHDLRKVAALLPDEELQPHHQALVNVMFAKKQRGYRKTAYNLADRVNSWRTEEQKLAARQAAKTSALAVAEPAPFRNRGFSERTIRALMDCSIDEPERLLFMQPANLKKIPGVGKAS
JGI12487J11892_101564JGI12487J11892_1015642F003090ARNAMEKKTVTDYKGYRIEVCPVGKGWRASIFSPGSIRPWPNSPANLEKSSAEELVAEAKRLIDARLGPQRL*
JGI12487J11892_101636JGI12487J11892_1016361F060758VTVRFSVTIRQVRDDGSEAPLQQELAAALAAPAEQFAGLAAWAAGEAGYLDHGEREKVIGQEGRELQRRLL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.