NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300000679

3300000679: Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23



Overview

Basic Information
IMG/M Taxon OID3300000679 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0075432 | Gp0054453 | Ga0001946
Sample NameTropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size5612930
Sequencing Scaffolds10
Novel Protein Genes10
Associated Families10

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1
All Organisms → cellular organisms → Bacteria2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha1
Not Available3
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_81
All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameTropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → tropical forest → forest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationLuquillo Experimental Forest Soil, Puerto Rico
CoordinatesLat. (o)18.0Long. (o)-65.0Alt. (m)N/ADepth (m).1
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018438Metagenome / Metatranscriptome235Y
F019273Metagenome230Y
F025553Metagenome / Metatranscriptome201Y
F036895Metagenome / Metatranscriptome169Y
F040358Metagenome / Metatranscriptome162N
F052920Metagenome / Metatranscriptome142Y
F075781Metagenome / Metatranscriptome118Y
F080462Metagenome / Metatranscriptome115Y
F083637Metagenome / Metatranscriptome112N
F092928Metagenome / Metatranscriptome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI12586J11914_100271All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1090Open in IMG/M
JGI12586J11914_100344All Organisms → cellular organisms → Bacteria953Open in IMG/M
JGI12586J11914_100577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis752Open in IMG/M
JGI12586J11914_100583All Organisms → cellular organisms → Bacteria749Open in IMG/M
JGI12586J11914_100868All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidisarcina → Acidisarcina polymorpha640Open in IMG/M
JGI12586J11914_101105Not Available584Open in IMG/M
JGI12586J11914_101271Not Available555Open in IMG/M
JGI12586J11914_101502All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium GW2011_GWA2_47_8521Open in IMG/M
JGI12586J11914_101537Not Available518Open in IMG/M
JGI12586J11914_101540All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium517Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI12586J11914_100271JGI12586J11914_1002712F080462MNSKQEHPIQALGFWMFGFLSVVLAILKLTVAGYWSWWRVMLPLLAFLGHNAVYLLAGFLCFCWLKHEEDEEEPTTVQKHSREGYNLAALLFFFLFLDNLLRRVEGQ
JGI12586J11914_100344JGI12586J11914_1003441F036895LLHGHYSASLLLRTLPPPSRLRSFSRLCRLYDLPCSGDFSPGRGGLLQLLSMSLPPCCRFHPAEIEMPRRSDFGTPCCLRPSVAGSALGSTHFRGHLRVHFRYGPVTRDLPKGDLVDRLQSLGCPPPCYPNYGAPDCCPGRFVSC*
JGI12586J11914_100577JGI12586J11914_1005771F083637VVICSVTLALGLAGCGWAGKTPIIGKGKAPAPVVTKG*
JGI12586J11914_100583JGI12586J11914_1005833F052920MRHEVHSHGTAACIAPFSERTDVHWETTNLPVWNAEGAAEQQELVYEVSWIKELGMWRRFLTSRCKVGSGRQEVPC*
JGI12586J11914_100868JGI12586J11914_1008681F018438MGIDDKSSHPELCLEVAGGVTRTIVGLFREPDAGNPPVRFDEREQETELCQTGLRRRCKNFVNSHRETNATAPVLDSTQNPPQWLLVKYSNRFVDFPRWP
JGI12586J11914_101105JGI12586J11914_1011053F019273RTNKKYPFKQMQPGETFKLNDEDVRNAQKMAWYYRTRCKRPIRIIIAKSDDGFHCHRID*
JGI12586J11914_101271JGI12586J11914_1012711F040358MRIAIFALAVLAGGGAAEAGQIEVISASPRHIEIAAWCWTAGSNCQQEASDVAQGYCHGSDYPDYPRRALYVRSGLVERGFFSERVIFVYRCNRRSIICEAGSC*
JGI12586J11914_101502JGI12586J11914_1015022F075781RVDNQTKCSFSSKEPAMTAGAVIKKAFPVVMVSVLDSKDGSVEVIK*
JGI12586J11914_101537JGI12586J11914_1015372F025553MASPLNYAANKSGKIKSPSKKKAGLNVSPALVSREGRGKIFFLDILFHRMSEIADLTVNHRNASL
JGI12586J11914_101540JGI12586J11914_1015401F092928VAQGLGDAGRQAPRHEESDCRAGPPVGGDHAPRLG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.