| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000507 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047444 | Gp0054550 | Ga0011578 |
| Sample Name | Coal-degrading lab enrichment microbial communities from Bowden, Alberta, Canada- QSAFCN5 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | McGill University |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 28712273 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bowden, Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 51.9740275 | Long. (o) | -113.8051889 | Alt. (m) | N/A | Depth (m) | 324 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030486 | Metagenome / Metatranscriptome | 185 | Y |
| F074913 | Metagenome / Metatranscriptome | 119 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Draft_104106 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1997 | Open in IMG/M |
| Draft_104906 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1776 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Draft_104106 | Draft_1041064 | F074913 | MWRWRRVAVARVFALVVRCRVMMLFVYSRVGKNRDTRRESPAGAGAGRGASHKTASLFTQLSRHGAPMTYTDLL* |
| Draft_104906 | Draft_1049064 | F030486 | MLAANVRRYVALPQSRGGACFCTRGAVQDYAVISYFSR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |