x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300000400
3300000400: Rhopaloeides odorabile microbial communities from Palm Island, Great Barrier Reef, Australia - replicate 1
Overview
| Basic Information |
| IMG/M Taxon OID | 3300000400 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0074055 | Gp0054543 | Ga0011438 |
| Sample Name | Rhopaloeides odorabile microbial communities from Palm Island, Great Barrier Reef, Australia - replicate 1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | J. Craig Venter Institute |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 10584864 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information |
| Location | Palm Island, Great Barrier Reef, Australia |
| Coordinates | Lat. (o) | -30.33 | Long. (o) | 146.58 | Alt. (m) | N/A | Depth (m) | 4000.85 |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
| F040218 | Metagenome | 162 | N |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
| BBAY34_1009365 | BBAY34_10093651 | F040218 | VLWKLAEKVREVVAAGKVVRIEDDLGSHLTATYDGTRLYGMQFRAGDPPGRCHFPWGRCGVFNGNGKADGEVFLSCVQGVAGELPAPMKWVVKDSEVVEAEGGELAEECRQLFKNVPGSNRLVEIMFGYHPKASIQHGIADPMHW |