| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300000143 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046785 | Gp0053421 | Ga0026198 |
| Sample Name | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 10m |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 13836185 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Funariidae → Funariales → Funariaceae → Physcomitrium → Physcomitrium patens | 1 |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1 |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → coastal inlet → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Saanich Inlet 53, Vancouver Island, BC, Canada | |||||||
| Coordinates | Lat. (o) | 48.6 | Long. (o) | -123.5 | Alt. (m) | N/A | Depth (m) | 10 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015265 | Metagenome / Metatranscriptome | 256 | Y |
| F025141 | Metagenome / Metatranscriptome | 203 | Y |
| F031720 | Metagenome | 182 | N |
| F093220 | Metagenome / Metatranscriptome | 106 | N |
| F103879 | Metagenome / Metatranscriptome | 101 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| SI53jan11_10mDRAFT_c100064 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Bryophyta → Bryophytina → Bryopsida → Funariidae → Funariales → Funariaceae → Physcomitrium → Physcomitrium patens | 5824 | Open in IMG/M |
| SI53jan11_10mDRAFT_c101263 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1349 | Open in IMG/M |
| SI53jan11_10mDRAFT_c103736 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 658 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| SI53jan11_10mDRAFT_c100064 | SI53jan11_10mDRAFT_1000641 | F103879 | INVVLSTQMTEMNPLPFTKETVYHANAATLVTWGIFDLLSEIAFFKQTNRKLQGTSEIILGMETCYDTYAHEFAEQLGDRFSPLGWDSQLERVQAGIDQVNPESRLMTHFRRLTQKNKETVGVGKSWVQVTQSGLSRIVESRGDLKRDRQREARFSLRNWSYRQEFALARRTLYWRERGQMRFHSSQYNMMNVTSIDHNQNSRLTRLYFRDMLIESRQKRALRVSIEPTIYDTFATRKLVVRARKPVAEASQLLAGDLLHVWFDWAKTYSNL* |
| SI53jan11_10mDRAFT_c101263 | SI53jan11_10mDRAFT_1012632 | F025141 | MIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK* |
| SI53jan11_10mDRAFT_c102057 | SI53jan11_10mDRAFT_1020571 | F031720 | KMNISLNTVLTEAYEISSGLQERLEGIYPIKCNLNFSGLPAMSLCLDHREQRLKSSASKNPQFTLIIDSNTTWNLLKEQTIPSDKIEGXSELALMFLIILAESNIDLELLIYKNFGTVPGLIIRKILSQDFLNDNQKAENIRVRSLQTSLRNISIRMDRMEQKQAL* |
| SI53jan11_10mDRAFT_c103448 | SI53jan11_10mDRAFT_1034483 | F093220 | SNVKIDRMQENLNIIDKNVRVLEKIVDTAENNLIAAINNACNVKTN* |
| SI53jan11_10mDRAFT_c103736 | SI53jan11_10mDRAFT_1037361 | F015265 | MYPDHMTKNPKLIETNAIVNLNNVGLPVFLNPIYAIIPMASPTKNPTRFSIFSNKNSNGV |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |