| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2228664013 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047444 | Gp0053501 | Ga0011239 |
| Sample Name | Tailings pond microbial communities from Northern Alberta -TP6_2010 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | McGill University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 103823675 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Type | Engineered |
| Taxonomy | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Canada: Alberta | |||||||
| Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.55 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F020363 | Metagenome / Metatranscriptome | 224 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2231979349 | Not Available | 545 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| 2231979349 | 2231877080 | F020363 | VARVFALVVRCRVMLLFVYSRVGKNRDTRRGSPAGAGAGRTADRLTFLFSQKVLAVREANDIYRPVMRRNNSY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |