NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2209111020

2209111020: Grass soil microbial communities from Rothamsted Park, UK - FC (Ethanol 20%) assembled



Overview

Basic Information
IMG/M Taxon OID2209111020 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046710 | Gp0052422 | Ga0011216
Sample NameGrass soil microbial communities from Rothamsted Park, UK - FC (Ethanol 20%) assembled
Sequencing StatusFinished
Sequencing Center454 Life Sciences
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28248687
Sequencing Scaffolds9
Novel Protein Genes9
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameGrass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil → Grass Soil Microbial Communities From Rothamsted Park Plot 3D, Harpenden, Uk

Alternative Ecosystem Assignments
Environment Ontology (ENVO)grassland biome → land → grassland soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationRothamsted, Harpenden, UK
CoordinatesLat. (o)51.804241Long. (o)-0.372114Alt. (m)N/ADepth (m)0 to .21
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001212Metagenome / Metatranscriptome746Y
F002275Metagenome576Y
F002725Metagenome / Metatranscriptome534Y
F005766Metagenome / Metatranscriptome391Y
F016332Metagenome / Metatranscriptome248Y
F025824Metagenome / Metatranscriptome200Y
F026221Metagenome / Metatranscriptome198Y
F034867Metagenome / Metatranscriptome173Y
F094369Metagenome / Metatranscriptome106N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
2221164948All Organisms → cellular organisms → Bacteria994Open in IMG/M
2221165870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria959Open in IMG/M
2221166973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria905Open in IMG/M
2221169784All Organisms → cellular organisms → Bacteria799Open in IMG/M
2221171098All Organisms → cellular organisms → Bacteria23181Open in IMG/M
2221175256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1659Open in IMG/M
2221176502All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
2221178932All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia514Open in IMG/M
2221179772All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1462Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
22211649482221950683F026221MLAADVAYKMRNRCLLMSILALASSAMLATSSFAAEAGTTEHEGVSLKPQMLVQLAASESQTRCW
22211658702221953261F001212MWEECIRCKEAPAVDDQGYCGHCHWAVRAEVEEGFYAIREYLRAWARFDEWCEGRGIAA
22211669732221955321F025824MRDMRRMRITVIGVALAIVVPIAALVPFLGIPILLVLPLVMGFWYMFYMPRWRRRVREQARSLRKWKLSPE
22211697842221960954F002275MRVVAVMLLLSAGIAAEAVSYSFVSKASGRLGGPIRFEFYRDSTTRPKTDIESFTVSMRTADDRWKAMWSILSGRGLTQPIEYGVTPPGFTTMIQPQKLIPRSRLLRVRY
22211710982221963660F034867MARMQMLNTKGAAKRLGCSETWIHRLVSTGKLKAYAYDDNGRLVKRKPDEKKQGQAMAFRVRDVDAYQPVVQRRPRGSKNKQPHFHEQHVKTA
22211752562221970656F094369MEEGYTQLGTVLTDQRPEDSEADGVIVVGRFKGDPYDGVQLSYDAGRRTCT
22211765022221972528F002725LSSRIPSGVILGLLQAHRLDAGGPSPPASFGEPDLRLANRDGARISAAEITAILGRRRAIERALRAIAPDASLAGAAASVPWLPLGQLFGAFAGIRGVGMSKMTKALYRKRPALIPILDSIVQGYLQEDDLGAQAPLGSARSGSSAATGAIWTATGPR
22211789322221976324F005766MGSLRRLQHRRRGRFAGLRYRFGLGRQAPWILLEDRFGYDRFHDTPQSGNDNAVNLRGGVALTKRIALEGGYAFESFVAPNDFYDRQLHRADARMVFDVTSSLQLALGYSYQEGDVISYAVPPRPEIARFSVERENEDEFGQPLRTAYKLLGRTHALSFSAAYQL
22211797722221978317F016332AYKEALKTLLIPIFLSTEQRWNGDPHLNAKQHTTLIQTQCVLSNAARSECNTERKLDLAMQSQLMREAAQAFVLA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.