NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2199352009

2199352009: Marine subseafloor sediment microbial communities, sample from White Oak River Estuary, NC, USA 14E



Overview

Basic Information
IMG/M Taxon OID2199352009 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063499 | Gp0053901 | Ga0026539
Sample NameMarine subseafloor sediment microbial communities, sample from White Oak River Estuary, NC, USA 14E
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size22398301
Sequencing Scaffolds11
Novel Protein Genes12
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon M9B1D1
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4
Not Available2
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-11
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium1
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Sediment Microbial Communities From The Peru Margin, Gulf Of Mexico And South Pacific Gyre
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Peru Margin, Gulf Of Mexico And South Pacific Gyre

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → intertidal zone → marine sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationWhite Oak River Estuary, North Carolina, subseafloor sediments from , Sample 14E; 24 centimeters below seafloor
CoordinatesLat. (o)34.690251Long. (o)-77.106571Alt. (m)N/ADepth (m).24
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000713Metagenome / Metatranscriptome925Y
F014681Metagenome / Metatranscriptome261Y
F030967Metagenome183Y
F057079Metagenome136Y
F059606Metagenome / Metatranscriptome133Y
F061500Metagenome / Metatranscriptome131Y
F082626Metagenome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
2200341204All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon M9B1D4139Open in IMG/M
2200342069All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1296Open in IMG/M
2200344274All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1253Open in IMG/M
2200345117Not Available1232Open in IMG/M
2200349224All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1028Open in IMG/M
2200349930All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Thermoplasmatales → unclassified Thermoplasmatales → Thermoplasmatales archaeon SG8-52-18254Open in IMG/M
2200354428All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → unclassified Cytophagales → Cytophagales bacterium613Open in IMG/M
2200356322All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2269Open in IMG/M
2200356330All Organisms → Viruses → unclassified viruses → Circular genetic element sp.2262Open in IMG/M
2200357708All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2143Open in IMG/M
2200366025Not Available1681Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
22003412042200735276F014681MKLKNLKNNLHGVVDLGVVLMIGIAFVSLMVISYIMYQVGSSLGATGDAANTIANISAGFDSAISLILIAITIFILAIAISALLLLRGGR
22003420692200736003F061500MLEDPEQILETIKKRELDIEILQLQLKHNLTKKRAESKLVIMYYKACNAISRTKLMMHGINGHEIKAPQPPNPVDPWNDHHQKRF
22003442742200737535F059606MKTEHAFALIALILGIVGGVLLCKGAIDLASKLFEGSRHISIESPLLIVIGVVAIIASAMLWTGRYLAGGVTNIILGIITVFYGKDAEGLMILISGVLGIVAPKIKD
22003451172200738129F014681MNKLVGFYLFLKSLLKPFKKDNAGVIDLGIVLMIGIAFAALMVIAYIIYTIRDQLIDNTTGAEVNATLANITTGFDNAVNLLLIAITIFILAIAIAALLMLRGR
22003492242200741602F057079MVKRSPYEAAWILGLIAGIVCILFALFSFLGYIPEILEKPIKGLTGMVSAGVLGILGFLILGAARMTKAGGKKATTGGIFLLIFGFVAYLVGGAIGAVIAILA
22003499302200743616F014681MKLRSLKNNIRAIINIELILMIGIAFAGMMVGAFIIWTLVDSLGATGDAALSIANITTGFDSTVNLLLVAITIFILALAISALLLLRQR
22003544282200753299F030967VNVEELKRLEEFEKRLNKLEAHGFEDTLTLVEILSSITFFGGLKMEKCKYAKEGQCGFFFLKNEAKKKIPMASDCRIKDCTGEPDHCHLELSNVTCAFCPKARIP
22003563222200756884F082626MNEKEQILVETVMDMLSGTAENMIRDPYHAPALWLIENWWHTLNAALQVGDHLDNKSDSFKATDETESKKRDEDI
22003563302200756926F082626MHEKARVLIETVMDMLNGTLDTMKEDEFHAPAAWLLENWWCSLNAALQVGNHLHNKANSFEATDQTESEKRDKNIQPDESFEV
22003577082200759293F057079MVKRTLYEAAWILGLIAGIVCILFAVFSFLGYIPEILEKPIKGLTGMVSAGVLGILGFLILGAARMAKAGGKKATTGGIFMLIFGVAAYLVGGAIGAAIAVLTGLLAIIARYV
22003660252200772504F082626MNEKEQILVETVMDMLSGTAENMIRDPFHAPALWLIENWWHTLNAALQVGNHLDNKSDSFKATDEAESKKGDENVESDEPFKV
22003710122200779599F000713MPLVKKRLTIAAGATSDQVLQGTTYEYVDPGTQLVVAAGDASGTYSGQVTMDFTVNNAEFSKDAVVSEEVTGEAFGWRGGYILNDMVTTGQVRNRPVITFTNGSGASATIDVAIFIGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.