| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2149837015 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0047181 | Gp0052328 | Ga0026456 |
| Sample Name | Human fecal microbial communities from the University of Arizona (HMP) - Ef1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Chinese National Human Genome Center, Beijing |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 16681402 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Bacteroides phage B40-8 | 1 |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Bording, Denmark | |||||||
| Coordinates | Lat. (o) | 56.128817 | Long. (o) | 9.239502 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F055775 | Metagenome | 138 | N |
| F089054 | Metagenome | 109 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| STU__NODE_1022_len_8874_cov_12_166780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Bacteroides phage B40-8 | 8896 | Open in IMG/M |
| STU__NODE_1508_len_11491_cov_32_124706 | All Organisms → cellular organisms → Bacteria | 11513 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| STU__NODE_1022_len_8874_cov_12_166780 | STU_0906.00000060 | F055775 | MAQIAQQDNLVIEVTTTAEALDGDTKKKLIECIEGGTITDVILVTKEAEKEISHARVVSWLVDTTGDSPKYTIDIINANSGTVKAIALN |
| STU__NODE_1508_len_11491_cov_32_124706 | STU_0348.00001130 | F089054 | MLTKGKFLVSFEVPGHTKEYTEGFTEEMVIPYRTEELNPYLRYPNQEINNNHLHSEHIRLQIREMLQIPLSDITIIDIISLP |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |