| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2149837012 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0046224 | Gp0052265 | Ga0011147 |
| Sample Name | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Beijing Genomics Institute (BGI), Lifesequencing S.L. |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 78990894 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 5 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → rhizosphere → soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Sierra Nevada National Park, Granada, Spain | |||||||
| Coordinates | Lat. (o) | 36.95744 | Long. (o) | -3.46336 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001351 | Metagenome / Metatranscriptome | 717 | Y |
| F003586 | Metagenome / Metatranscriptome | 478 | Y |
| F031719 | Metagenome / Metatranscriptome | 182 | Y |
| F065095 | Metagenome / Metatranscriptome | 128 | Y |
| F074192 | Metagenome / Metatranscriptome | 120 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| _F7QKVOU01ERW65 | Not Available | 521 | Open in IMG/M |
| _GD4IA4401BJ3BS | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| _GD4IA4401BTL3P | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| _GD4IA4401BXZWA | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| _GD4IA4401CHAFO | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| _F7QKVOU01ERW65 | LJQ_0114.00000030 | F031719 | ATKVLAAFAIAALAVGSFSAVALAGKKKKTAVVYFNTSPKFNKGGQVTAKGTLNTASACKPGRGMRLQLLDSTGTVTATLDGSTSDLTGNWKLQGQLPKGVPAGTNSVRVKATKASAGKLVCKAGVSVPVPVPAT |
| _GD4IA4401BJ3BS | LJQ_0685.00000080 | F003586 | NNVWQWTMAKKKLTKTERAEMNARHARVLENARRTRELAERAQAKLEAQRSSE |
| _GD4IA4401BTL3P | LJQ_0407.00000060 | F001351 | MKLRAIFLGIVILTAPLGAGTERLSMKVSPAVAFAPANLVVRAMIPADADNRSVEITAESDDFYRSSQVQLEGDRAPRVNQFEFRSLPPGTYEVRALLIGANGEQRALARQQVNVIAAAVGPND |
| _GD4IA4401BXZWA | LJQ_0379.00000070 | F065095 | MAEIDQKQYIERAIVRARDGVGDRIDELDRHLRTNLDPKTLARTYAPHLIAAGGVVGVIVGFGLPKVLRKVVTWGVPLTILALTIKNVRDAREESLIGNS |
| _GD4IA4401CHAFO | LJQ_0246.00000070 | F074192 | MEPEAWPTPQTPAREPLPRVEDLPVADQGYDQESVKAAFDSFYRHAAQLDAALRTLEAVDSFHRHAASLRADLRA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |