x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 2084038015
2084038015: Soil microbial community from Hopland, California, USA, that is PCE polluted - amended with molasses
Overview
| Basic Information |
| IMG/M Taxon OID | 2084038015 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0046478 | Gp0051956 | Ga0011101 |
| Sample Name | Soil microbial community from Hopland, California, USA, that is PCE polluted - amended with molasses |
| Sequencing Status | Permanent Draft |
| Sequencing Center | GATC-Biotech AG, Konstanz, Germany |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 4159211 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Soil Microbial Community From Hopland, California, Usa, That Is Pce Polluted |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Contaminated → Soil → Soil Microbial Community From Hopland, California, Usa, That Is Pce Polluted |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | terrestrial biome → land → contaminated soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information |
| Location | Hopland, California, USA |
| Coordinates | Lat. (o) | 38.9727 | Long. (o) | -123.1145 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F024779 | Metagenome / Metatranscriptome | 204 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| SPCE_M_FSPRUNR02GT95O | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 501 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| SPCE_M_FSPRUNR02GT95O | SPCE_M_00004400 | F024779 | MEKEKDLIKAETPKQDGSTDPSLIGSETERFRAIVDVKHNEAVTGESGVPAKMRDHELRCQKRSLEEFS |
