| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2051223005 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045401 | Gp0051701 | Ga0011001 |
| Sample Name | Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10373 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Maryland School of Medicine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 25401028 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → unclassified Collinsella → Collinsella sp. | 1 |
| Not Available | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Orebro University Hospital, Sweden | |||||||
| Coordinates | Lat. (o) | 59.274717 | Long. (o) | 15.230656 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080673 | Metagenome | 115 | N |
| F093883 | Metagenome | 106 | N |
| F099269 | Metagenome | 103 | N |
| F102167 | Metagenome | 102 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| mhc9b_MHC9B_contig03086 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1273 | Open in IMG/M |
| mhc9b_MHC9B_contig09749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Coriobacteriia → Coriobacteriales → Coriobacteriaceae → Collinsella → unclassified Collinsella → Collinsella sp. | 3562 | Open in IMG/M |
| mhc9b_MHC9B_contig15000 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 638 | Open in IMG/M |
| mhc9b_MHC9B_contig20044 | Not Available | 1260 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| mhc9b_MHC9B_contig03086 | MHC9B_contig03086_metagene_gene_3 | F080673 | MDEIMKLQDEALLYLRDNITKDEAYYILTTDKDMIEILIANKKDGSKRIKVLDVEYTIEKDDMLFLFDTDGVIDECLLVASYIGVNMYFRRQDVNAILNNINREEVMKYPYIAIQLDNIQTVEKRRVVFEITGHRMDDNKERIDFMFVYFMARML |
| mhc9b_MHC9B_contig09749 | MHC9B_contig09749_metagene_gene_3 | F099269 | LPTHAKGGLRGDAEASFFVHGVLLSVQVGELLLLDDLGDRAGGASVLASATGDAGILVSDGGDVLELQNASGAGVDANATSDALVGINYGMSHGSFLSVDRRYRRCAPV |
| mhc9b_MHC9B_contig15000 | MHC9B_contig15000_metagene_gene_2 | F102167 | VVDLIDHGIIDLDIMNGKMMGEYVAMLMIRSYEKATKSYTLTSFSFHDKDMDKLRMLIGNAIMAVGYRNNPLTGDGNTAIK |
| mhc9b_MHC9B_contig20044 | MHC9B_contig20044_metagene_gene_1 | F093883 | KRLYSDIEDRTKKIALKSSSLIKEEDFVVLHEMTHKIQMLNIEAVKVNSRLMFIIQLATSFGMDLDLDTTYASTAKSIIEDRTSGFVFYDDKERLRYADKELEDMFHDMSVTEVSKIGVVQSYELLMKQYNEFKEIKANATGKTKADEQGCRSGKR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |