


| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2030936005 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045518 | Gp0051577 | Ga0026435 |
| Sample Name | Cyphomyrmex longiscapus fungus garden microbial communities from Gamboa, Panama |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 36087604 |
| Sequencing Scaffolds | 0 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Built Environment → City → Subway → Unclassified → City Subway Metal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Fungus → Fungus corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gamboa, Panama | |||||||
| Coordinates | Lat. (o) | 40.68 | Long. (o) | -79.7 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F014998 | Metagenome / Metatranscriptome | 258 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| CLOF_F4EQGSL02GHM9V | CLOFG_1484690 | F014998 | VGLGAAQLMSGLESGSIEAANLNPPFLYFAKRKGFRELLDLGAHAQMPLGGLTASNAAIQNRAAELKRVIRSMQIARRTLLQSKEKGVDFIMRTIKVDRETAEDSFEDYRKTSSGSGVPSRKGMEEIIKSLQLLGQFTGKKLASKKWLTQESPGRSPGSSVTKWTSC |
| ⦗Top⦘ |