| Basic Information | |
|---|---|
| IMG/M Taxon OID | 2022920008 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0045212 | Gp0051338 | Ga0026352 |
| Sample Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP4 Joseph's Coat Springs |
| Sequencing Status | Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 14407932 |
| Sequencing Scaffolds | 2 |
| Novel Protein Genes | 2 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. | 1 |
| All Organisms → Viruses → Predicted Viral | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | aquatic biome → hot spring → spring water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Yellowstone National Park, WY | |||||||
| Coordinates | Lat. (o) | 44.733519 | Long. (o) | -110.333 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013155 | Metagenome / Metatranscriptome | 274 | Y |
| F080679 | Metagenome | 115 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| YNPsite04_CeleraDRAF_49295 | All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp. | 719 | Open in IMG/M |
| YNPsite04_CeleraDRAF_scf1118686607418 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| YNPsite04_CeleraDRAF_49295 | YNPsite04_CeleraDRAFT_176960 | F013155 | MELYQMAVIAIALANLAVTVWLLRLLIPIWQTLRKVVFALDNFDFDEISKKFLSNEKPLAEAVDIKVSEKKEEGYRELTVTRVYKKPLDPREI |
| YNPsite04_CeleraDRAF_scf1118686607418 | YNPsite04_CeleraDRAFT_172990 | F080679 | MMDEDAISKILSRKGLRIIRYLYNNDYATLRTLEKALRINGVTAREYIDLLSKYGIVKVSRVGRAYVIMLNREGKYTKAIIEFLKQVSYL |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |