NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 2013515000

2013515000: Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP6 White Creek Site 3



Overview

Basic Information
IMG/M Taxon OID2013515000 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0045212 | Gp0051323 | Ga0026299
Sample NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP6 White Creek Site 3
Sequencing StatusDraft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size38275783
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families7

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available5
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium OLB111
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)aquatic biome → hot spring → spring water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationYellowstone National Park, WY
CoordinatesLat. (o)44.733519Long. (o)-110.404033Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002371Metagenome / Metatranscriptome566Y
F009196Metagenome / Metatranscriptome321Y
F041593Metagenome / Metatranscriptome159Y
F041787Metagenome / Metatranscriptome159N
F056643Metagenome / Metatranscriptome137N
F068995Metagenome124Y
F080677Metagenome / Metatranscriptome115N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
YNP6_C551Not Available879Open in IMG/M
YNP6_FUBG14678_g1Not Available849Open in IMG/M
YNP6_FUBG18553_g1All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium OLB11813Open in IMG/M
YNP6_FUBG33494_g1Not Available791Open in IMG/M
YNP6_FUBG34939_b1Not Available832Open in IMG/M
YNP6_FUBG4549_g1Not Available847Open in IMG/M
YNP6_FUBG731_b1All Organisms → cellular organisms → Bacteria836Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
YNP6_C551YNP6_11740F080677MISIIFLMKKEFLQELLENVAWWSLGWFALLSGLLNLTQGFWGWLSAICFLLASMVTLPIFWSWLTSKIIVLQSPKLVRKITIGAMFLLLLAVMLTPVSVDQQTTFASEVRSDSTTELPIVKQPTETVPLIIKLISSLGG
YNP6_FUBG14678_g1YNP6_307680F002371MKNKKSQRGGIRKGSGPKPKYHEKTKTVSFRCPVSKINDLKTAVKSKLNEWI
YNP6_FUBG18553_g1YNP6_421460F041593MAAEPMHNKLYKLAIRMNRVNGKGVKRNLDYLLRQLEERNKAHSDYIQQGLPIL
YNP6_FUBG33494_g1YNP6_461320F009196HDLLLAARHSLLAITRRQMRQVLRRAGQEGTNAGTVAPFVNLPPEVLPDFRRLHEIETALAAGQMPPPPDAAAENRVTPRAVPARLPETHLRTGPPSITDRTAGSEPPARHPFPEVIRHE
YNP6_FUBG34939_b1YNP6_529390F041787VPNAVLYQGTPLTRTADGRYTIFDPTATPPQRFAGILSRDWQTDASGNGIFRHCYPNCGMVEVCMYVSGMFRISDMKITTDELNAIVAQGRGFVHGDPNTLSGVLQLF
YNP6_FUBG4549_g1YNP6_251330F056643VASQANWSDAAQLPVRIIPVLGGLRLIEGGVYTATRATRAVWEIDDLLLVRDVGMGRGVADTATALVEYVEEYVAKLRFAWLARGDVQLINVFGNIDVIRYGERAYEGVTMTVRFAHLIRSPSV
YNP6_FUBG731_b1YNP6_245830F068995MTKGEGCERQAVCRVAYVRNARSTYHVSESDKRTVAALAKAPRFLRGCDRPCTKTMTLLPRSQIQGHTGIGYQMINVDGYRWVNAYVISDALNSTNQRGFTLEISFSLQPFVYGVGVVGEARYFFNFDAFYDPGAGSHKLIRVETSDLTSTGGLPHIGGVDLTHILRVPVMGPYLRASVFNEDTVARHATVEAYLTT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.