


| Basic Information | |
|---|---|
| Taxon OID | 3300034656 Open in IMG/M |
| Scaffold ID | Ga0326748_003002 Open in IMG/M |
| Source Dataset Name | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2174 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater → Extreme Environments Viral Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 13.3325 | Long. (o) | -44.9106 | Alt. (m) | Depth (m) | 2477 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004772 | Metagenome / Metatranscriptome | 424 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326748_003002_1858_2172 | F004772 | AGGAG | MTTNIKVAQNVSSDGAIITGFRYVETNTSLGDEGTGSSPTPSTTRVLAMHTYSTLAGEIVISGSKQITNRSAKGTAIRYRVAALDSNDQYIGDMGVGVHGIVSVA |
| ⦗Top⦘ |