NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0370515_0000425

Scaffold Ga0370515_0000425


Overview

Basic Information
Taxon OID3300034163 Open in IMG/M
Scaffold IDGa0370515_0000425 Open in IMG/M
Source Dataset NamePeat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)19088
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (73.68%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil → Peat Soil Microbial Communities From Wetland Fen In Alaska, United States

Source Dataset Sampling Location
Location NameUSA: Alaska
CoordinatesLat. (o)64.9123Long. (o)-147.839Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001759Metagenome / Metatranscriptome640Y
F002337Metagenome / Metatranscriptome569Y
F008209Metagenome / Metatranscriptome337Y

Sequences

Protein IDFamilyRBSSequence
Ga0370515_0000425_5967_6506F002337GGAGMNLAIVLVIAAVLALATILSVAVTRSLQVRGSAGLPETIRPIDVEAFRNLINPAEDLYLRRRLPSAQFRVVRRQRLRAMQAYVQVAASNAAVLVRAGQAALASGDPRVTQAAHELVNDALLLRRNATIALARIYLALAWPNSGFAAVRVVDRYEQLSGAAMLLGRLQNPAVPVRLSALL
Ga0370515_0000425_7370_7546F008209GGGGGMKVSRFAFSNKEKTIVKRLLLVIAAALMLVNTLVVPTVAHADGGTGTTNCGGNTICKP
Ga0370515_0000425_7621_8064F001759N/AMTLKSALQDLRETTLAAVSGLLAKLAYLGSLRRREGGYLHWGMSLVHGEEAAERALKSAHTEVLSNVLRTPIPALVEDLRESSRHSEKTAGAYVEGMRGQFSELLPVPEDAASARHLNSVLVALSSLEKSQKRATPSASSPPLPPAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.