NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310130_0252627

Scaffold Ga0310130_0252627


Overview

Basic Information
Taxon OID3300034073 Open in IMG/M
Scaffold IDGa0310130_0252627 Open in IMG/M
Source Dataset NameFracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)555
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.784Long. (o)-98.26Alt. (m)Depth (m)2896
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010451Metagenome / Metatranscriptome303Y

Sequences

Protein IDFamilyRBSSequence
Ga0310130_0252627_3_290F010451GGAGMKVANGNDKLGKGCLVVSRPVGDTCPSSCAFLGNGCYAEQTEKMYPNVRPAGMQNLITERGRIRSMILDAKSQSKSIRWHERGDWFLNGELDLDYL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.