


| Basic Information | |
|---|---|
| Taxon OID | 3300033893 Open in IMG/M |
| Scaffold ID | Ga0326768_016877 Open in IMG/M |
| Source Dataset Name | Hot spring sediment microbial communities from Norris-Mammoth Corridor, Yellowstone National Park, WY, United States - NMC.RSW_S |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1567 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → unclassified Methanomassiliicoccales → Methanomassiliicoccales archaeon | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.7535 | Long. (o) | -110.7249 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019254 | Metagenome | 231 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326768_016877_422_685 | F019254 | AGG | MPSEKIQEALSHLQDDWPLRVLLSALAERVAELAALLGQAEARKLPPEFRTRIRAIEEEMHALSRLCQNPPRPEMGNRRKVDSLPLF |
| ⦗Top⦘ |