


| Basic Information | |
|---|---|
| Taxon OID | 3300033892 Open in IMG/M |
| Scaffold ID | Ga0326767_000267 Open in IMG/M |
| Source Dataset Name | Hot spring water microbial communities from Norris-Mammoth Corridor, Yellowstone National Park, WY, United States - NMC.RSE_P |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 16879 |
| Total Scaffold Genes | 26 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 16 (61.54%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Hot Spring Water → Hot Spring Microbial Communities From Different Geyser Basins In Yellowstone National Park, Wy, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.7535 | Long. (o) | -110.7249 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F018029 | Metagenome / Metatranscriptome | 237 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326767_000267_9608_9931 | F018029 | AGG | MNLLQRIIWKKIHKEELDQEEMRDLMDYLNTLKEELHKLRIILYNDYVGYICDFDVIMKEPWYCSEVRFKCLQLGEYGFLYLDDFIWRLATGGIEVKPFIKTEVIRS |
| ⦗Top⦘ |