


| Basic Information | |
|---|---|
| Taxon OID | 3300033755 Open in IMG/M |
| Scaffold ID | Ga0371489_0397217 Open in IMG/M |
| Source Dataset Name | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 634 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil → Lab Enriched Peat Soil Microbial Communities From Two Peatlands Near Ithaca, Ny, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: McLean, Ithaca, New York | |||||||
| Coordinates | Lat. (o) | 42.5488 | Long. (o) | -76.2662 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F085019 | Metagenome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0371489_0397217_1_270 | F085019 | GAGG | MCGPRARERAARVEDAARLTPSHAFALAHPLDDASRLAAAEAVPDAVVEMQPQRGGAVEVAMGGQPNHVVKAVAGASGLDGGGVPGRSR |
| ⦗Top⦘ |