


| Basic Information | |
|---|---|
| Taxon OID | 3300033428 Open in IMG/M |
| Scaffold ID | Ga0334896_1053124 Open in IMG/M |
| Source Dataset Name | Sludge microbial communities from methane-producing bioreactor in Wageningen University, Netherlands - Granular Sludge_27_06-R3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 949 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Sludge → Sludge Microbial Communities From Methane-Producing Bioreactor In Wageningen University, Netherlands |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Netherlands: Wageningen, Gelderland | |||||||
| Coordinates | Lat. (o) | 51.9691 | Long. (o) | 5.6654 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F089495 | Metagenome / Metatranscriptome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0334896_10531242 | F089495 | AGGAGG | MGRPYLRKSHVDVRFYDGTATTPYTLDITGYSDIPELPEPVIDVAAEPYVVGGNFNSIEEGDDAVTLPEFAITIDINDADVVTGKYAIDQWFANHKEGTGTTALVSTNDGSAYLKKSIDGTTTSANLSTDYFTIGLKVLFDNGGSGKAFGKDFKYIRPIDAKFS |
| ⦗Top⦘ |