


| Basic Information | |
|---|---|
| Taxon OID | 3300033180 Open in IMG/M |
| Scaffold ID | Ga0307510_10090451 Open in IMG/M |
| Source Dataset Name | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2907 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oregon | |||||||
| Coordinates | Lat. (o) | 45.654 | Long. (o) | -122.839 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F057783 | Metagenome | 135 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307510_100904515 | F057783 | GGAGG | VDVTTGLIRGEAFRDANLGGTVGITTSPYRGEAFRDAVWGGTVGATTGPCCGEVFRDAVLGGTVGVTTGPYRGEVFRDAVLGGTVGITTSPCLGEVFRDAILGGTVGRTTGPCLGEAFRDAILGGTVGVTTGPCCGEAFRDAILGGTVGVTTGPCCGVIDTVGVTTGSYLAILRCDATMLVLGGDIMGETTDSLIMSLYSPCRWAIMHCVGSMPW |
| ⦗Top⦘ |