NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0335072_10099677

Scaffold Ga0335072_10099677


Overview

Basic Information
Taxon OID3300032898 Open in IMG/M
Scaffold IDGa0335072_10099677 Open in IMG/M
Source Dataset NameSoil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3719
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States

Source Dataset Sampling Location
Location NameUSA: Florida
CoordinatesLat. (o)26.5059Long. (o)-80.2517Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000534Metagenome / Metatranscriptome1044Y
F001318Metagenome / Metatranscriptome724Y

Sequences

Protein IDFamilyRBSSequence
Ga0335072_100996771F001318GGAGGMKRWAWILVVLILISCAVAQVSTPLSLQTEHPSSTPPPISSPSSSQGDWHDAGPSERMFFPRDMFWGWAQFDLAPPHNEIDPNLCAGNAAQLGGINDPCTMFARYMLSGILEVRPFGRGPLRRFMVYGAPTFLFGKNIPQTLYTWSPDAIGIEHSWGAGIYLNKGFEFRVTQHFLFDRLGARSGNVGAGDLGTNGPWGRYMT
Ga0335072_100996772F000534AGGAMPQEISVSYQAIKSKVYRLIDALVVGEKSEAEVQESVRRWWALIHPADRPIAQKYLLMVLGRSNSALDAMGTELLSVSSPDVVRPQLEEASHQAKRMRLMDRMMKETSVRTAV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.