


| Basic Information | |
|---|---|
| Taxon OID | 3300032770 Open in IMG/M |
| Scaffold ID | Ga0335085_10012596 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12450 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 12 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil → Soil Microbial Communities From Loxahatchee National Wildlife Refuge, Florida, United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Florida | |||||||
| Coordinates | Lat. (o) | 26.5052 | Long. (o) | -80.2345 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012365 | Metagenome / Metatranscriptome | 281 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0335085_1001259612 | F012365 | AGGAG | MAEPRYVVVYAATYPTVAAARAVLDTIKHLHKEVDGTYDAAVVDKQDGKAHVVGRIDRPHVQVIPEWFGRGALTRQELNEAAEELLAAEAGLIVVGEATIEPAVDKAFTSTPKVFKREIEATIDQITSELQEAFKG |
| ⦗Top⦘ |