


| Basic Information | |
|---|---|
| Taxon OID | 3300032697 Open in IMG/M |
| Scaffold ID | Ga0214499_1080723 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 986 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 42.39 | Long. (o) | -85.37 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004023 | Metagenome / Metatranscriptome | 456 | Y |
| F009305 | Metagenome / Metatranscriptome | 319 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0214499_10807231 | F004023 | N/A | ITLTIAANVVHTVFLFHGKFYXXIFTDKNLNTDTLIRLAYAHYLSAFYMAYLGLLHGIDMHYDXKNETSYDGLEVEMSXXDEALSNELGSFLELIFLLNLVCXXLYPEPEALSYEIFMXGDIGMVSDVRFYGVAPHXYFRPYMAXLIVCPHHKTGIFGLLYLFLVLFHQPTLPPNLL |
| Ga0214499_10807232 | F009305 | N/A | NELGTFIEAIFVLNIICXXLYPEPEALSYEIFMXGDIGLISDVRFYGVAPHXYFRPYMAXLIVCPHHKTGIFGLLYLFLVLFHQPTLHGINEHNLYYKRKLLFSSLKTKQKVFFKQSYLSIELNLFFQTTYTFFIMCGLYTFTFLPYGRFYNRLGGNVGXXNKTKNKYNKPKIPVLXCGHTINQAI |
| ⦗Top⦘ |