


| Basic Information | |
|---|---|
| Taxon OID | 3300032373 Open in IMG/M |
| Scaffold ID | Ga0316204_10337000 Open in IMG/M |
| Source Dataset Name | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1159 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Maine | |||||||
| Coordinates | Lat. (o) | 43.8603 | Long. (o) | -69.5781 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096218 | Metagenome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316204_103370003 | F096218 | GGAG | MKNLIIKWLGLDKLESLIDLRITQLQDGTVDAVINDLDNRYDLQGMESKLDDMDYLTQDLESRGNRWDDMADKVEDDSDTFLLDKVQSVDDRLTELVAGYKLDVQLVKEEF |
| ⦗Top⦘ |