


| Basic Information | |
|---|---|
| Taxon OID | 3300032273 Open in IMG/M |
| Scaffold ID | Ga0316197_10004395 Open in IMG/M |
| Source Dataset Name | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 10014 |
| Total Scaffold Genes | 13 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 10 (76.92%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Netherlands | |||||||
| Coordinates | Lat. (o) | 51.4666 | Long. (o) | 4.071 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F099326 | Metagenome / Metatranscriptome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316197_100043954 | F099326 | GGGGG | MANLVLQLGESVDFAIRGSCMKAFGDGASVRVRRQRVYLPGDVVVVRRRDHWNAHRFLGYAPSVHGLLVLTQADDAAERDPAALASAIVGRAQCETRVSDRLAALGNYALAMIRKAAELG |
| ⦗Top⦘ |