


| Basic Information | |
|---|---|
| Taxon OID | 3300032157 Open in IMG/M |
| Scaffold ID | Ga0315912_10028140 Open in IMG/M |
| Source Dataset Name | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4544 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.0136 | Long. (o) | -118.4673 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070609 | Metagenome | 123 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315912_100281401 | F070609 | GAG | MKKLLWLAIIGLVAVYGVGRFNLGETGAVRFLMEMESLVNDGKTEEVCAMFHDELEFEVEDHSGESTESASGGKKEFCELTTVTVAGLKLLPHSMEVEFTDITSKQELSKPWTGSASYSEHRTFNIPAANVSLRTVSEDEITLVQTFSGVKLLKLKSAIYKAEAS |
| ⦗Top⦘ |