


| Basic Information | |
|---|---|
| Taxon OID | 3300032136 Open in IMG/M |
| Scaffold ID | Ga0316201_11265110 Open in IMG/M |
| Source Dataset Name | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 615 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow → Sediment Chemolithoautotrophic Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Delaware | |||||||
| Coordinates | Lat. (o) | 38.7869 | Long. (o) | -75.1074 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005331 | Metagenome / Metatranscriptome | 404 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0316201_112651101 | F005331 | AGGAG | MGRFQAQEPTGVAVQELEMLVRTVIFKPATALVGWLLQ |
| ⦗Top⦘ |