


| Basic Information | |
|---|---|
| Taxon OID | 3300031967 Open in IMG/M |
| Scaffold ID | Ga0315914_1074769 Open in IMG/M |
| Source Dataset Name | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 518 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Euphorbiaceae → Acalyphoideae → Acalypheae → Ricinus → Ricinus communis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Nodule → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California | |||||||
| Coordinates | Lat. (o) | 34.06 | Long. (o) | -118.44 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002299 | Metagenome | 573 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315914_10747691 | F002299 | AGG | MTSSRGRSWALGDRLAVSLATAKRLPSAKDSLLTPDARTSKAFSDGHMLLSIDSYGIST |
| ⦗Top⦘ |