


| Basic Information | |
|---|---|
| Taxon OID | 3300031965 Open in IMG/M |
| Scaffold ID | Ga0326597_10029129 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7043 |
| Total Scaffold Genes | 11 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (81.82%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Uranium-Contaminated Sites Across The Upper Colorado River Basin Region |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 42.9888 | Long. (o) | -108.3994 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F095438 | Metagenome / Metatranscriptome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0326597_100291298 | F095438 | AGGA | MADPGRLLRLADEMAGRAAEDEGFAGLAVLTAHAALESLVNQLGREEIGSFNERARFLPKWHDLCERTMGKQLDAAPDLERLHALRDGVAGFSGPPERLDRRSAAPPPEVPPALSAETARWAVDAARRVVEEFHSGVGRERPDWLD |
| ⦗Top⦘ |