


| Basic Information | |
|---|---|
| Taxon OID | 3300031785 Open in IMG/M |
| Scaffold ID | Ga0310343_10204503 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1352 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater → Comprehensive Metagenome And Single Cell Genome Sequencing From The Open Ocean Community Of North Pacfic Subtropical Gyre, Station Aloha |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: North Pacific Subtropical Gyre | |||||||
| Coordinates | Lat. (o) | 22.8367 | Long. (o) | -158.0236 | Alt. (m) | Depth (m) | 25 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F035364 | Metagenome | 172 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0310343_102045031 | F035364 | N/A | MLGLSKASKAKKVYDSIESQLSSIKDWANSDKLPKKMWIDPYMIGYFFKTVALAELITNRKPYSATPDQMIIKLCFEDHICPESFKDFEQNLFNLMDKELKAKKSGALKFDDLGNHISSNVEKDVDEFLLGNRHASRIIFLLGGVLKEEIIQKDHQILEAKKITEENKEMDEAAAKKLGLKSRNMLPFYL |
| ⦗Top⦘ |