


| Basic Information | |
|---|---|
| Taxon OID | 3300031701 Open in IMG/M |
| Scaffold ID | Ga0302120_10016490 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3238 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (44.44%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: Western Arctic Ocean | |||||||
| Coordinates | Lat. (o) | 70.5467 | Long. (o) | -122.9077 | Alt. (m) | Depth (m) | 625 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001606 | Metagenome | 664 | N |
| F004658 | Metagenome | 429 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0302120_100164902 | F004658 | N/A | MTVKMPEYLKKVYDFFKTNNTAKDVLIGAVSFIAGGYILNKIVKRDEDQDEE |
| Ga0302120_100164909 | F001606 | GAGG | MTYGYDDVTFTSTAAGSTAEVQLNTATSLSAPDPAHGFLACIPYQMELGAFTTNQSLLTAFRIQSDDVSVEPKKFVLPNVNTGDAAFTSVAAPALLAYPINTPLAGGEHLNFYAEPLTSNVVAAGVGATVIYDTDGTNGAEQYYTRPTNENASSVTINTRTQGGDMTIQGGNEITGLYTVVSGATATASEHDVGYSEFISPDFETSMPYRVAVQPTATGLGAAANAITGGGGIMQYNM |
| ⦗Top⦘ |