


| Basic Information | |
|---|---|
| Taxon OID | 3300031660 Open in IMG/M |
| Scaffold ID | Ga0307994_1006786 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5678 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (100.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Oceanospirillales → Oceanospirillaceae → unclassified Oceanospirillaceae → Oceanospirillaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southern Ocean | |||||||
| Coordinates | Lat. (o) | -68.5958 | Long. (o) | 78.1913 | Alt. (m) | Depth (m) | 18 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F061294 | Metagenome / Metatranscriptome | 132 | Y |
| F098084 | Metagenome / Metatranscriptome | 104 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0307994_10067861 | F061294 | GAGG | VQAIDAFESRCVDYQNHCITSESTALVVYLLSHNVVYEEVNYMMPEHPPTVELLSIIVKDVCRGKSPYTPVFEQIVARYLDLVGDEGVSPQVIFYYVSNVIISLLVLSRQNSQLSAEILAKLIQRFNFRDAVLRAGVEVIAEEV |
| Ga0307994_10067865 | F098084 | GAG | MLYTQLTTIRIGLLLLLLLVVSVTSYAGMPKQCDKPMHSDHIIYDCYGDWAVRHVFERGVLKHKYSDATTIMDVGWFGSTEFQINRRQDGSIYYIIPSQIDRVEIIIAGQTFVSKQGPSAVFYGEVTEPMLAAISQAQSPVNLLIYSEGQTIKASFSETGSSAALRWIGAID |
| ⦗Top⦘ |