


| Basic Information | |
|---|---|
| Taxon OID | 3300031587 Open in IMG/M |
| Scaffold ID | Ga0315308_1000603 Open in IMG/M |
| Source Dataset Name | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 20304 |
| Total Scaffold Genes | 20 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (70.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Freshwater Sediment Microbial Communities From Lake Towuti, South Sulawesi, Indonesia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Indonesia: South Sulawesi | |||||||
| Coordinates | Lat. (o) | -2.7726 | Long. (o) | 121.4938 | Alt. (m) | Depth (m) | 1 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050736 | Metagenome / Metatranscriptome | 145 | Y |
| F056130 | Metagenome / Metatranscriptome | 138 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0315308_10006034 | F050736 | GAGG | VPAPTISHLILTGSLIAVVFTVQIFYFYVVDNVWAEMTRRELKELSDYVADTLANLYFLVNGTNTNPTLTKTLRLPLDIGGSSYTLEITRDGNYNAQTVKSSLKEKSWLSSTAWLPKGLKVDTGKTQVIESSAKTVVAGCQRVTSNIRIWIAYQG |
| Ga0315308_10006035 | F056130 | N/A | VRRLRTIPFFRNNKAASYTISAMIMTAVTVALVLAAFVYAYQVLERQRGQSEWEVAKKSILAFNDALETVAWKSAGATRSTRFSVQYGYLQLIPNANNITISAIVNGQFKPLSNTTYPGKTGVIKYCLSTSYVTFDANYESWILGNSSSVITGSGSSYGRAVIRQDPGVVSISLDYRVRAMRTSVINVTGVGANINYVDIWVIKLPMLVSKPWSYVHDFDLQARALSVRTASHWFPSVTNQTSVVKVQIGSGQSQVPITLTVPGSVVFNVIVADVQVNV |
| ⦗Top⦘ |