NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307388_10509274

Scaffold Ga0307388_10509274


Overview

Basic Information
Taxon OID3300031522 Open in IMG/M
Scaffold IDGa0307388_10509274 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)792
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)-51.9926Long. (o)2.0992Alt. (m)Depth (m)50
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F063319Metatranscriptome129N

Sequences

Protein IDFamilyRBSSequence
Ga0307388_105092741F063319N/AKSPKSGKETSCDLFQKNMPSRPISGTLLWVTFAYLAVTNLVASLPVDEQILPDSSGEDHLSDNFVVCTSSADCYPISPSILISILGGLGENLSTSASENDVNIDIPQRRGISGSYLFRSKKADGEKEKKSNRRGGYLFRTKKMGRSTRGDYLFRTRKFDPAPNRSYLFRTK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.