


| Basic Information | |
|---|---|
| Taxon OID | 3300031520 Open in IMG/M |
| Scaffold ID | Ga0272428_1063828 Open in IMG/M |
| Source Dataset Name | Rock endolithic microbial communities from Victoria Land, Antarctica - Finger Mt nord |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2697 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Victoria Land | |||||||
| Coordinates | Lat. (o) | -77.9 | Long. (o) | 161.57 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F034417 | Metagenome | 174 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0272428_10638283 | F034417 | AGGAGG | MPWAIVQPRDAWLAQARDAWTALEPHAPQGAQLRDLAAIDHDHFAQLIEALCALTPGQVSQELQDLAGLRPVGEVLGMPEPGDADKDADDTDLGDW |
| ⦗Top⦘ |