NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307979_1024515

Scaffold Ga0307979_1024515


Overview

Basic Information
Taxon OID3300031398 Open in IMG/M
Scaffold IDGa0307979_1024515 Open in IMG/M
Source Dataset NameMarine microbial communities from Ellis Fjord, Antarctic Ocean - #1058
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2135
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Organic Lake
CoordinatesLat. (o)-68.457Long. (o)78.1911Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029618Metagenome187Y

Sequences

Protein IDFamilyRBSSequence
Ga0307979_10245151F029618N/APVIGRYGGASSDLSLILDLVAREMARKHTAFYNIGFSEAKALIRQKLARKWGHAIARGWATLLLDRLRGFVLVPSSAGGNSSFELHSQCMEERATLDRYHHFHGHSGMCA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.